Lineage for d1ieba1 (1ieb A:82-182)
- Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) 
Protein Class II MHC alpha chain, C-terminal domain [88618] (7 species) 
Species Mouse (Mus musculus), I-E group [TaxId:10090] [88622] (9 PDB entries)
probably orthologous to the human HLA-DR group
Domain d1ieba1: 1ieb A:82-182 [21635]
Other proteins in same PDB: d1ieba2, d1iebb1, d1iebb2, d1iebc2, d1iebd1, d1iebd2
complexed with nag, ndg, so4
Details for d1ieba1
PDB Entry: 1ieb (more details), 2.7 Å
PDB Description: histocompatibility antigen
PDB Compounds: (A:) MHC class II I-ekSCOPe Domain Sequences for d1ieba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ieba1 b.1.1.2 (A:82-182) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-E group [TaxId: 10090]}
danvapevtvlsrspvnlgepnilicfidkfsppvvnvtwlrngrpvtegvsetvflprd
dhlfrkfhyltflpstddfydcevdhwgleeplrktwefee
SCOPe Domain Coordinates for d1ieba1:
Click to download the PDB-style file with coordinates for d1ieba1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ieba1:
View in 3D
