Lineage for d3sd7a_ (3sd7 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2919479Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2919480Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2920270Family c.108.1.0: automated matches [191369] (1 protein)
    not a true family
  6. 2920271Protein automated matches [190447] (55 species)
    not a true protein
  7. 2920384Species Clostridium difficile [TaxId:272563] [188776] (3 PDB entries)
  8. 2920385Domain d3sd7a_: 3sd7 A: [216346]
    automated match to d3mc1b_
    complexed with cl, gol, na, pge

Details for d3sd7a_

PDB Entry: 3sd7 (more details), 1.7 Å

PDB Description: 1.7 angstrom resolution crystal structure of putative phosphatase from clostridium difficile
PDB Compounds: (A:) putative phosphatase

SCOPe Domain Sequences for d3sd7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sd7a_ c.108.1.0 (A:) automated matches {Clostridium difficile [TaxId: 272563]}
kknyeivlfdldgtltdpkegitksiqyslnsfgikedlenldqfigpplhdtfkeyykf
edkkakeavekyreyfadkgifenkiyenmkeilemlykngkillvatskptvfaetilr
yfdidryfkyiagsnldgtrvnkneviqyvldlcnvkdkdkvimvgdrkydiigakkigi
dsigvlygygsfeeiseseptyivenvesikdill

SCOPe Domain Coordinates for d3sd7a_:

Click to download the PDB-style file with coordinates for d3sd7a_.
(The format of our PDB-style files is described here.)

Timeline for d3sd7a_: