Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.108.1: HAD-like [56784] (26 families) usually contains an insertion (sub)domain after strand 1 |
Family c.108.1.0: automated matches [191369] (1 protein) not a true family |
Protein automated matches [190447] (55 species) not a true protein |
Species Clostridium difficile [TaxId:272563] [188776] (3 PDB entries) |
Domain d3sd7a_: 3sd7 A: [216346] automated match to d3mc1b_ complexed with cl, gol, na, pge |
PDB Entry: 3sd7 (more details), 1.7 Å
SCOPe Domain Sequences for d3sd7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3sd7a_ c.108.1.0 (A:) automated matches {Clostridium difficile [TaxId: 272563]} kknyeivlfdldgtltdpkegitksiqyslnsfgikedlenldqfigpplhdtfkeyykf edkkakeavekyreyfadkgifenkiyenmkeilemlykngkillvatskptvfaetilr yfdidryfkyiagsnldgtrvnkneviqyvldlcnvkdkdkvimvgdrkydiigakkigi dsigvlygygsfeeiseseptyivenvesikdill
Timeline for d3sd7a_: