Lineage for d3scwa_ (3scw A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1339265Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1341162Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 1341163Protein automated matches [190075] (46 species)
    not a true protein
  7. 1341260Species Oryza sativa [TaxId:39947] [225407] (23 PDB entries)
  8. 1341282Domain d3scwa_: 3scw A: [216343]
    automated match to d1v03a_
    complexed with ctt, mes, so4, zn; mutant

Details for d3scwa_

PDB Entry: 3scw (more details), 1.9 Å

PDB Description: crystal structure of rice bglu1 e386g/y341a mutant complexed with cellotetraose
PDB Compounds: (A:) Beta-glucosidase 7

SCOPe Domain Sequences for d3scwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3scwa_ c.1.8.0 (A:) automated matches {Oryza sativa [TaxId: 39947]}
nwlgglsraafpkrfvfgtvtsayqvegmaasggrgpsiwdafahtpgnvagnqngdvat
dqyhrykedvnlmkslnfdayrfsiswsrifpdgegrvnqegvayynnlinyllqkgitp
yvnlyhydlplalekkyggwlnakmadlfteyadfcfktfgnrvkhwftfneprivallg
ydqgtnppkrctkcaaggnsatepyivahnfllshaaavaryrtkyqaaqqgkvgivldf
nwyealsnstedqaaaqrardfhigwyldplinghypqimqdlvkdrlpkftpeqarlvk
gsadyiginqytasymkgqqlmqqtptsysadwqvtavfakngkpigpqansnwlyivpw
gmygcvnyikqkygnptvvitgngmdqpanlsrdqylrdttrvhfyrsyltqlkkaideg
anvagyfawslldnfewlsgytskfgivyvdfntlerhpkasaywfrdmlkh

SCOPe Domain Coordinates for d3scwa_:

Click to download the PDB-style file with coordinates for d3scwa_.
(The format of our PDB-style files is described here.)

Timeline for d3scwa_: