SCOPe 2.03: Domain d3scvb_: 3scv B:

Lineage for d3scvb_ (3scv B:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.0: automated matches [191314] (1 protein)
   not a true family

6. Protein automated matches [190075] (46 species)
   not a true protein

7. Species Oryza sativa [TaxId:39947] [225407] (23 PDB entries)

8. Domain d3scvb_: 3scv B: [216342]
   automated match to d1v03a_
   complexed with ctt, mes, so4, zn; mutant

Details for d3scvb_

PDB Entry: 3scv, 2.11 Å

PDB Description: crystal structure of rice bglu1 e386g/s334a mutant complexed with cellotetraose

PDB Compounds: (B:) Beta-glucosidase 7

SCOPe Domain Sequences for d3scvb_:

Sequence; same for both SEQRES and ATOM records:

>d3scvb_ c.1.8.0 (B:) automated matches {Oryza sativa [TaxId: 39947]}
nwlgglsraafpkrfvfgtvtsayqvegmaasggrgpsiwdafahtpgnvagnqngdvat
dqyhrykedvnlmkslnfdayrfsiswsrifpdgegrvnqegvayynnlinyllqkgitp
yvnlyhydlplalekkyggwlnakmadlfteyadfcfktfgnrvkhwftfneprivallg
ydqgtnppkrctkcaaggnsatepyivahnfllshaaavaryrtkyqaaqqgkvgivldf
nwyealsnstedqaaaqrardfhigwyldplinghypqimqdlvkdrlpkftpeqarlvk
gsadyiginqytasymkgqqlmqqtptsyaadwqvtyvfakngkpigpqansnwlyivpw
gmygcvnyikqkygnptvvitgngmdqpanlsrdqylrdttrvhfyrsyltqlkkaideg
anvagyfawslldnfewlsgytskfgivyvdfntlerhpkasaywfrdmlkh

Timeline for d3scvb_:

• d3scvb_ is new in SCOPe 2.03-stable
  
• d3scvb_ appears in SCOPe 2.04
  
• d3scvb_ appears in the current release, SCOPe 2.08