| Class b: All beta proteins [48724] (141 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins) |
| Protein Class II MHC beta chain, C-terminal domain [88625] (6 species) |
| Species Mouse (Mus musculus), I-E group [TaxId:10090] [88629] (9 PDB entries) probably orthologous to the human HLA-DR group |
| Domain d1ieab1: 1iea B:93-188 [21632] Other proteins in same PDB: d1ieaa1, d1ieaa2, d1ieab2, d1ieac1, d1ieac2, d1iead2 |
PDB Entry: 1iea (more details), 2.3 Å
SCOP Domain Sequences for d1ieab1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ieab1 b.1.1.2 (B:93-188) Class II MHC beta chain, C-terminal domain {Mouse (Mus musculus), I-E group}
rrveptvtvyptktqplehhnllvcsvsdfypgnievrwfrngkeektgivstglvrngd
wtfqtlvmletvpqsgevytcqvehpsltdpvtvew
Timeline for d1ieab1: