Lineage for d1d9kg1 (1d9k G:82-182)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 548299Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 548801Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species)
  7. 548851Species Mouse (Mus musculus), I-A group [TaxId:10090] [88624] (10 PDB entries)
    probably orthologous to the human HLA-DQ group
  8. 548865Domain d1d9kg1: 1d9k G:82-182 [21629]
    Other proteins in same PDB: d1d9ka_, d1d9kb_, d1d9kc2, d1d9kd1, d1d9kd2, d1d9ke_, d1d9kf_, d1d9kg2, d1d9kh1, d1d9kh2

Details for d1d9kg1

PDB Entry: 1d9k (more details), 3.2 Å

PDB Description: crystal structure of complex between d10 tcr and pmhc i-ak/ca

SCOP Domain Sequences for d1d9kg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d9kg1 b.1.1.2 (G:82-182) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-A group}
atneapqatvfpkspvllgqpntlicfvdnifppvinitwlrnsksvtdgvyetsffvnr
dysfhklsyltfipsdddiydckvehwgleepvlkhwepei

SCOP Domain Coordinates for d1d9kg1:

Click to download the PDB-style file with coordinates for d1d9kg1.
(The format of our PDB-style files is described here.)

Timeline for d1d9kg1: