SCOPe 2.02: Domain d1d9kc1: 1d9k C:82-182

Lineage for d1d9kc1 (1d9k C:82-182)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species)

7. Species Mouse (Mus musculus), I-A group [TaxId:10090] [88624] (26 PDB entries)
   probably orthologous to the human HLA-DQ group

8. Domain d1d9kc1: 1d9k C:82-182 [21627]
   Other proteins in same PDB: d1d9ka_, d1d9kb_, d1d9kc2, d1d9kd1, d1d9kd2, d1d9ke_, d1d9kf_, d1d9kg2, d1d9kh1, d1d9kh2
   complexed with ndg

Details for d1d9kc1

PDB Entry: 1d9k, 3.2 Å

PDB Description: crystal structure of complex between d10 tcr and pmhc i-ak/ca

PDB Compounds: (C:) MHC I-ak a chain (alpha chain)

SCOPe Domain Sequences for d1d9kc1:

Sequence; same for both SEQRES and ATOM records:

>d1d9kc1 b.1.1.2 (C:82-182) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]}
atneapqatvfpkspvllgqpntlicfvdnifppvinitwlrnsksvtdgvyetsffvnr
dysfhklsyltfipsdddiydckvehwgleepvlkhwepei

Timeline for d1d9kc1:

• d1d9kc1 first appeared (with stable ids) in SCOP 1.55
  
• d1d9kc1 appears in SCOPe 2.01
  
• d1d9kc1 appears in SCOPe 2.03
  
• d1d9kc1 appears in the current release, SCOPe 2.08