![]() | Class b: All beta proteins [48724] (149 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
![]() | Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species) |
![]() | Species Mouse (Mus musculus), I-A group [TaxId:10090] [88624] (10 PDB entries) probably orthologous to the human HLA-DQ group |
![]() | Domain d1d9kc1: 1d9k C:82-182 [21627] Other proteins in same PDB: d1d9ka_, d1d9kb_, d1d9kc2, d1d9kd1, d1d9kd2, d1d9ke_, d1d9kf_, d1d9kg2, d1d9kh1, d1d9kh2 |
PDB Entry: 1d9k (more details), 3.2 Å
SCOP Domain Sequences for d1d9kc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d9kc1 b.1.1.2 (C:82-182) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-A group} atneapqatvfpkspvllgqpntlicfvdnifppvinitwlrnsksvtdgvyetsffvnr dysfhklsyltfipsdddiydckvehwgleepvlkhwepei
Timeline for d1d9kc1: