Lineage for d1d9kc1 (1d9k C:82-182)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 220405Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 220734Protein Class II MHC, C-terminal domains of alpha and beta chains [49132] (12 species)
  7. 220827Species Mouse (Mus musculus), I-AK [TaxId:10090] [49138] (3 PDB entries)
  8. 220830Domain d1d9kc1: 1d9k C:82-182 [21627]
    Other proteins in same PDB: d1d9ka_, d1d9kb_, d1d9kc2, d1d9kd2, d1d9ke_, d1d9kf_, d1d9kg2, d1d9kh2

Details for d1d9kc1

PDB Entry: 1d9k (more details), 3.2 Å

PDB Description: crystal structure of complex between d10 tcr and pmhc i-ak/ca

SCOP Domain Sequences for d1d9kc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d9kc1 b.1.1.2 (C:82-182) Class II MHC, C-terminal domains of alpha and beta chains {Mouse (Mus musculus), I-AK}
atneapqatvfpkspvllgqpntlicfvdnifppvinitwlrnsksvtdgvyetsffvnr
dysfhklsyltfipsdddiydckvehwgleepvlkhwepei

SCOP Domain Coordinates for d1d9kc1:

Click to download the PDB-style file with coordinates for d1d9kc1.
(The format of our PDB-style files is described here.)

Timeline for d1d9kc1: