Lineage for d1iaka1 (1iak A:82-181)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 452577Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 453045Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species)
  7. 453095Species Mouse (Mus musculus), I-A group [TaxId:10090] [88624] (10 PDB entries)
    probably orthologous to the human HLA-DQ group
  8. 453096Domain d1iaka1: 1iak A:82-181 [21625]
    Other proteins in same PDB: d1iaka2, d1iakb1, d1iakb2

Details for d1iaka1

PDB Entry: 1iak (more details), 1.9 Å

PDB Description: histocompatibility antigen i-ak
PDB Compounds: (A:)

SCOP Domain Sequences for d1iaka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iaka1 b.1.1.2 (A:82-181) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-A group}
atneapqatvfpkspvllgqpntlicfvdnifppvinitwlrnsksvtdgvyetsffvnr
dysfhklsyltfipsdddiydckvehwgleepvlkhwepe

SCOP Domain Coordinates for d1iaka1:

Click to download the PDB-style file with coordinates for d1iaka1.
(The format of our PDB-style files is described here.)

Timeline for d1iaka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1iaka2