Class b: All beta proteins [48724] (144 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species) |
Species Mouse (Mus musculus), I-A group [TaxId:10090] [88624] (10 PDB entries) probably orthologous to the human HLA-DQ group |
Domain d1iaka1: 1iak A:82-181 [21625] Other proteins in same PDB: d1iaka2, d1iakb1, d1iakb2 |
PDB Entry: 1iak (more details), 1.9 Å
SCOP Domain Sequences for d1iaka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iaka1 b.1.1.2 (A:82-181) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-A group} atneapqatvfpkspvllgqpntlicfvdnifppvinitwlrnsksvtdgvyetsffvnr dysfhklsyltfipsdddiydckvehwgleepvlkhwepe
Timeline for d1iaka1: