SCOP 1.65: Domain d1iaka1: 1iak A:82-181

Lineage for d1iaka1 (1iak A:82-181)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species)

7. Species Mouse (Mus musculus), I-A group [TaxId:10090] [88624] (10 PDB entries)
   probably orthologous to the human HLA-DQ group

8. Domain d1iaka1: 1iak A:82-181 [21625]
   Other proteins in same PDB: d1iaka2, d1iakb1, d1iakb2
   complexed with nag

Details for d1iaka1

PDB Entry: 1iak, 1.9 Å

PDB Description: histocompatibility antigen i-ak

SCOP Domain Sequences for d1iaka1:

Sequence; same for both SEQRES and ATOM records:

>d1iaka1 b.1.1.2 (A:82-181) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-A group}
atneapqatvfpkspvllgqpntlicfvdnifppvinitwlrnsksvtdgvyetsffvnr
dysfhklsyltfipsdddiydckvehwgleepvlkhwepe

Timeline for d1iaka1:

• d1iaka1 first appeared (with stable ids) in SCOP 1.55
  
• d1iaka1 appears in SCOP 1.63
  
• d1iaka1 appears in SCOP 1.67
  
• d1iaka1 appears in the current release, SCOPe 2.08