Class b: All beta proteins [48724] (126 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins) |
Protein Class II MHC beta chain, C-terminal domain [88625] (6 species) |
Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88628] (23 PDB entries) probably orthologous to the mouse I-E group |
Domain d1d5xb1: 1d5x B:93-190 [21624] Other proteins in same PDB: d1d5xa1, d1d5xa2, d1d5xb2, d1d5xc1, d1d5xc2 complexed with ace, haq |
PDB Entry: 1d5x (more details), 2.45 Å
SCOP Domain Sequences for d1d5xb1:
Sequence, based on SEQRES records: (download)
>d1d5xb1 b.1.1.2 (B:93-190) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DR group} rrvypevtvypaktqplqhhnllvcsvngfypgsievrwfrngqeektgvvstgliqngd wtfqtlvmletvprsgevytcqvehpsltspltvewra
>d1d5xb1 b.1.1.2 (B:93-190) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DR group} rrvypevtvypaknllvcsvngfypgsievrwfrngqeektgvvstgliqngdwtfqtlv mletvprsgevytcqvehpsltspltvewra
Timeline for d1d5xb1:
View in 3D Domains from other chains: (mouse over for more information) d1d5xa1, d1d5xa2, d1d5xc1, d1d5xc2 |