Lineage for d1d5xa1 (1d5x A:82-181)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 8163Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 8374Protein Class II MHC, C-terminal domains of alpha and beta chains [49132] (9 species)
  7. Species Human (Homo sapiens), HLA-DR4 [TaxId:9606] [49137] (4 PDB entries)
  8. 8420Domain d1d5xa1: 1d5x A:82-181 [21623]
    Other proteins in same PDB: d1d5xa2, d1d5xb2, d1d5xc1, d1d5xc2

Details for d1d5xa1

PDB Entry: 1d5x (more details), 2.45 Å

PDB Description: x-ray crystal structure of hla-dr4 complexed with dipeptide mimetic and seb

SCOP Domain Sequences for d1d5xa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d5xa1 b.1.1.2 (A:82-181) Class II MHC, C-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DR4}
itnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpre
dhlfrkfhylpflpstedvydcrvehwgldepllkhwefd

SCOP Domain Coordinates for d1d5xa1:

Click to download the PDB-style file with coordinates for d1d5xa1.
(The format of our PDB-style files is described here.)

Timeline for d1d5xa1: