Class b: All beta proteins [48724] (176 folds) |
Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) this domain is C-terminal to the catalytic beta/alpha barrel domain |
Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins) this domain follows the catalytic beta/alpha barrel domain |
Protein Melibiase [75020] (4 species) |
Species Human (Homo sapiens) [TaxId:9606] [101919] (17 PDB entries) alpha-galactosidase A |
Domain d3s5ya2: 3s5y A:324-421 [216220] Other proteins in same PDB: d3s5ya1, d3s5yb1 automated match to d1r46a1 complexed with 2pe, acy, dgj, edo, nag |
PDB Entry: 3s5y (more details), 2.1 Å
SCOPe Domain Sequences for d3s5ya2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3s5ya2 b.71.1.1 (A:324-421) Melibiase {Human (Homo sapiens) [TaxId: 9606]} lgkqgyqlrqgdnfevwerplsglawavaminrqeiggprsytiavaslgkgvacnpacf itqllpvkrklgfyewtsrlrshinptgtvllqlentm
Timeline for d3s5ya2: