Lineage for d1d6eb1 (1d6e B:93-190)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2025133Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2026816Protein Class II MHC beta chain, C-terminal domain [88625] (6 species)
  7. 2026824Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88628] (41 PDB entries)
    Uniprot P04229 30-219
    probably orthologous to the mouse I-E group
  8. 2026837Domain d1d6eb1: 1d6e B:93-190 [21622]
    Other proteins in same PDB: d1d6ea1, d1d6ea2, d1d6eb2, d1d6ec1, d1d6ec2

Details for d1d6eb1

PDB Entry: 1d6e (more details), 2.45 Å

PDB Description: crystal structure of hla-dr4 complex with peptidomimetic and seb
PDB Compounds: (B:) hla class II histocompatibility antigen

SCOPe Domain Sequences for d1d6eb1:

Sequence, based on SEQRES records: (download)

>d1d6eb1 b.1.1.2 (B:93-190) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]}
rrvypevtvypaktqplqhhnllvcsvngfypgsievrwfrngqeektgvvstgliqngd
wtfqtlvmletvprsgevytcqvehpsltspltvewra

Sequence, based on observed residues (ATOM records): (download)

>d1d6eb1 b.1.1.2 (B:93-190) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]}
rrvypevtvypallvcsvngfypgsievrwfrngqeektgvvstgliqngdwtfqtlvml
etvprsgevytcqvehpsltspltvewra

SCOPe Domain Coordinates for d1d6eb1:

Click to download the PDB-style file with coordinates for d1d6eb1.
(The format of our PDB-style files is described here.)

Timeline for d1d6eb1: