Lineage for d1d6eb1 (1d6e B:93-190)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 548299Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 548888Protein Class II MHC beta chain, C-terminal domain [88625] (6 species)
  7. 548896Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88628] (29 PDB entries)
    probably orthologous to the mouse I-E group
  8. 548906Domain d1d6eb1: 1d6e B:93-190 [21622]
    Other proteins in same PDB: d1d6ea1, d1d6ea2, d1d6eb2, d1d6ec1, d1d6ec2
    complexed with ace

Details for d1d6eb1

PDB Entry: 1d6e (more details), 2.45 Å

PDB Description: crystal structure of hla-dr4 complex with peptidomimetic and seb

SCOP Domain Sequences for d1d6eb1:

Sequence, based on SEQRES records: (download)

>d1d6eb1 b.1.1.2 (B:93-190) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DR group}
rrvypevtvypaktqplqhhnllvcsvngfypgsievrwfrngqeektgvvstgliqngd
wtfqtlvmletvprsgevytcqvehpsltspltvewra

Sequence, based on observed residues (ATOM records): (download)

>d1d6eb1 b.1.1.2 (B:93-190) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DR group}
rrvypevtvypallvcsvngfypgsievrwfrngqeektgvvstgliqngdwtfqtlvml
etvprsgevytcqvehpsltspltvewra

SCOP Domain Coordinates for d1d6eb1:

Click to download the PDB-style file with coordinates for d1d6eb1.
(The format of our PDB-style files is described here.)

Timeline for d1d6eb1: