![]() | Class b: All beta proteins [48724] (110 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies) |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (6 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
![]() | Protein Class II MHC, C-terminal domains of alpha and beta chains [49132] (11 species) |
![]() | Species Human (Homo sapiens), HLA-DR4 [TaxId:9606] [49137] (4 PDB entries) |
![]() | Domain d1d6eb1: 1d6e B:93-190 [21622] Other proteins in same PDB: d1d6ea2, d1d6eb2, d1d6ec1, d1d6ec2 |
PDB Entry: 1d6e (more details), 2.45 Å
SCOP Domain Sequences for d1d6eb1:
Sequence, based on SEQRES records: (download)
>d1d6eb1 b.1.1.2 (B:93-190) Class II MHC, C-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DR4} rrvypevtvypaktqplqhhnllvcsvngfypgsievrwfrngqeektgvvstgliqngd wtfqtlvmletvprsgevytcqvehpsltspltvewra
>d1d6eb1 b.1.1.2 (B:93-190) Class II MHC, C-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DR4} rrvypevtvypallvcsvngfypgsievrwfrngqeektgvvstgliqngdwtfqtlvml etvprsgevytcqvehpsltspltvewra
Timeline for d1d6eb1:
![]() Domains from other chains: (mouse over for more information) d1d6ea1, d1d6ea2, d1d6ec1, d1d6ec2 |