Lineage for d1d6eb1 (1d6e B:93-190)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 52912Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 53149Protein Class II MHC, C-terminal domains of alpha and beta chains [49132] (10 species)
  7. 53193Species Human (Homo sapiens), HLA-DR4 [TaxId:9606] [49137] (4 PDB entries)
  8. 53199Domain d1d6eb1: 1d6e B:93-190 [21622]
    Other proteins in same PDB: d1d6ea2, d1d6eb2, d1d6ec1, d1d6ec2

Details for d1d6eb1

PDB Entry: 1d6e (more details), 2.45 Å

PDB Description: crystal structure of hla-dr4 complex with peptidomimetic and seb

SCOP Domain Sequences for d1d6eb1:

Sequence, based on SEQRES records: (download)

>d1d6eb1 b.1.1.2 (B:93-190) Class II MHC, C-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DR4}
rrvypevtvypaktqplqhhnllvcsvngfypgsievrwfrngqeektgvvstgliqngd
wtfqtlvmletvprsgevytcqvehpsltspltvewra

Sequence, based on observed residues (ATOM records): (download)

>d1d6eb1 b.1.1.2 (B:93-190) Class II MHC, C-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DR4}
rrvypevtvypallvcsvngfypgsievrwfrngqeektgvvstgliqngdwtfqtlvml
etvprsgevytcqvehpsltspltvewra

SCOP Domain Coordinates for d1d6eb1:

Click to download the PDB-style file with coordinates for d1d6eb1.
(The format of our PDB-style files is described here.)

Timeline for d1d6eb1: