| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) ![]() |
| Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins) members of the family may contain various insert subdomains in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain |
| Protein Melibiase [75064] (4 species) |
| Species Human (Homo sapiens) [TaxId:9606] [102062] (11 PDB entries) alpha-galactosidase A |
| Domain d3s5ya1: 3s5y A:32-323 [216219] Other proteins in same PDB: d3s5ya2, d3s5yb2 automated match to d1r46a2 complexed with 2pe, acy, dgj, edo, nag |
PDB Entry: 3s5y (more details), 2.1 Å
SCOPe Domain Sequences for d3s5ya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3s5ya1 c.1.8.1 (A:32-323) Melibiase {Human (Homo sapiens) [TaxId: 9606]}
ldnglartptmgwlhwerfmcnldcqeepdsciseklfmemaelmvsegwkdagyeylci
ddcwmapqrdsegrlqadpqrfphgirqlanyvhskglklgiyadvgnktcagfpgsfgy
ydidaqtfadwgvdllkfdgcycdslenladgykhmslalnrtgrsivyscewplymwpf
qkpnyteirqycnhwrnfadiddswksiksildwtsfnqerivdvagpggwndpdmlvig
nfglswnqqvtqmalwaimaaplfmsndlrhispqakallqdkdviainqdp
Timeline for d3s5ya1: