SCOPe 2.05: Domain d3s5pa_: 3s5p A:

Lineage for d3s5pa_ (3s5p A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.121: Ribose/Galactose isomerase RpiB/AlsB [89622] (1 superfamily)
   3 layers: a/b/a, core: parallel beta-sheet of 5 strands, order 21354; topological similarity to a part of the arginase/deacetylase fold

4. Superfamily c.121.1: Ribose/Galactose isomerase RpiB/AlsB [89623] (2 families)

5. Family c.121.1.0: automated matches [191649] (1 protein)
   not a true family

6. Protein automated matches [191196] (7 species)
   not a true protein

7. Species Giardia lamblia [TaxId:184922] [226146] (1 PDB entry)

8. Domain d3s5pa_: 3s5p A: [216217]
   automated match to d3k7sb_
   complexed with so4

Details for d3s5pa_

PDB Entry: 3s5p, 2.3 Å

PDB Description: Crystal structure of ribose-5-phosphate isomerase B RpiB from Giardia lamblia

PDB Compounds: (A:) Ribose 5-phosphate isomerase

SCOPe Domain Sequences for d3s5pa_:

Sequence, based on SEQRES records:

>d3s5pa_ c.121.1.0 (A:) automated matches {Giardia lamblia [TaxId: 184922]}
pgsmkvafasdhggrdlrmflqqrasahgyevmdlgtesdasvdypdfakigceavtsgr
adccilvcgtgigisiaankmkgircalcsteydaemarkhnnanalalggrttgpevaa
silsrflstnfeggrhaariak

Sequence, based on observed residues (ATOM records):

>d3s5pa_ c.121.1.0 (A:) automated matches {Giardia lamblia [TaxId: 184922]}
pgsmkvafasdhggrdlrmflqqrasahgyevmdlgtpdfakigceavtsgradccilvc
gtgigisiaankmkgircalcsteydaemarkhnnanalalggrttgpevaasilsrfls
tnfeggrhaariak

Timeline for d3s5pa_:

• d3s5pa_ first appeared in SCOPe 2.03
  
• d3s5pa_ appears in SCOPe 2.04
  
• d3s5pa_ is called d3s5pa1 in SCOPe 2.06
  
• d3s5pa_ appears in the current release, SCOPe 2.08, called d3s5pa1