Lineage for d1d6ea1 (1d6e A:82-180)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 288543Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 288908Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species)
  7. 288913Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88621] (23 PDB entries)
    probably orthologous to the mouse I-E group
  8. 288920Domain d1d6ea1: 1d6e A:82-180 [21621]
    Other proteins in same PDB: d1d6ea2, d1d6eb1, d1d6eb2, d1d6ec1, d1d6ec2
    complexed with ace

Details for d1d6ea1

PDB Entry: 1d6e (more details), 2.45 Å

PDB Description: crystal structure of hla-dr4 complex with peptidomimetic and seb

SCOP Domain Sequences for d1d6ea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d6ea1 b.1.1.2 (A:82-180) Class II MHC alpha chain, C-terminal domain {Human (Homo sapiens), HLA-DR group}
itnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpre
dhlfrkfhylpflpstedvydcrvehwgldepllkhwef

SCOP Domain Coordinates for d1d6ea1:

Click to download the PDB-style file with coordinates for d1d6ea1.
(The format of our PDB-style files is described here.)

Timeline for d1d6ea1: