SCOP 1.57: Domain d1d6ea1: 1d6e A:82-180

Lineage for d1d6ea1 (1d6e A:82-180)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Class II MHC, C-terminal domains of alpha and beta chains [49132] (10 species)

7. Species Human (Homo sapiens), HLA-DR4 [TaxId:9606] [49137] (4 PDB entries)

8. Domain d1d6ea1: 1d6e A:82-180 [21621]
   Other proteins in same PDB: d1d6ea2, d1d6eb2, d1d6ec1, d1d6ec2

Details for d1d6ea1

PDB Entry: 1d6e, 2.45 Å

PDB Description: crystal structure of hla-dr4 complex with peptidomimetic and seb

SCOP Domain Sequences for d1d6ea1:

Sequence; same for both SEQRES and ATOM records:

>d1d6ea1 b.1.1.2 (A:82-180) Class II MHC, C-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DR4}
itnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpre
dhlfrkfhylpflpstedvydcrvehwgldepllkhwef

Timeline for d1d6ea1:

• d1d6ea1 first appeared (with stable ids) in SCOP 1.55
  
• d1d6ea1 appears in SCOP 1.59
  
• d1d6ea1 appears in the current release, SCOPe 2.08