Lineage for d1d6ea1 (1d6e A:82-180)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 8163Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 8374Protein Class II MHC, C-terminal domains of alpha and beta chains [49132] (9 species)
  7. Species Human (Homo sapiens), HLA-DR4 [TaxId:9606] [49137] (4 PDB entries)
  8. 8418Domain d1d6ea1: 1d6e A:82-180 [21621]
    Other proteins in same PDB: d1d6ea2, d1d6eb2, d1d6ec1, d1d6ec2

Details for d1d6ea1

PDB Entry: 1d6e (more details), 2.45 Å

PDB Description: crystal structure of hla-dr4 complex with peptidomimetic and seb

SCOP Domain Sequences for d1d6ea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d6ea1 b.1.1.2 (A:82-180) Class II MHC, C-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DR4}
itnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpre
dhlfrkfhylpflpstedvydcrvehwgldepllkhwef

SCOP Domain Coordinates for d1d6ea1:

Click to download the PDB-style file with coordinates for d1d6ea1.
(The format of our PDB-style files is described here.)

Timeline for d1d6ea1: