SCOP 1.61: Domain d1d5zb1: 1d5z B:93-190

Lineage for d1d5zb1 (1d5z B:93-190)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Class II MHC, C-terminal domains of alpha and beta chains [49132] (12 species)

7. Species Human (Homo sapiens), HLA-DR4 [TaxId:9606] [49137] (5 PDB entries)

8. Domain d1d5zb1: 1d5z B:93-190 [21620]
   Other proteins in same PDB: d1d5za2, d1d5zb2, d1d5zc1, d1d5zc2

Details for d1d5zb1

PDB Entry: 1d5z, 2 Å

PDB Description: x-ray crystal structure of hla-dr4 complexed with peptidomimetic and seb

SCOP Domain Sequences for d1d5zb1:

Sequence, based on SEQRES records:

>d1d5zb1 b.1.1.2 (B:93-190) Class II MHC, C-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DR4}
rrvypevtvypaktqplqhhnllvcsvngfypgsievrwfrngqeektgvvstgliqngd
wtfqtlvmletvprsgevytcqvehpsltspltvewra

Sequence, based on observed residues (ATOM records):

>d1d5zb1 b.1.1.2 (B:93-190) Class II MHC, C-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DR4}
rrvypevtvypallvcsvngfypgsievrwfrngqeektgvvstgliqngdwtfqtlvml
etvprsgevytcqvehpsltspltvewra

Timeline for d1d5zb1:

• d1d5zb1 first appeared (with stable ids) in SCOP 1.55
  
• d1d5zb1 appears in SCOP 1.59
  
• d1d5zb1 appears in SCOP 1.63
  
• d1d5zb1 appears in the current release, SCOPe 2.08