SCOP 1.65: Domain d1d5mb1: 1d5m B:93-190

Lineage for d1d5mb1 (1d5m B:93-190)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Class II MHC beta chain, C-terminal domain [88625] (6 species)

7. Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88628] (23 PDB entries)
   probably orthologous to the mouse I-E group

8. Domain d1d5mb1: 1d5m B:93-190 [21618]
   Other proteins in same PDB: d1d5ma1, d1d5ma2, d1d5mb2, d1d5mc1, d1d5mc2
   complexed with ace, nag

Details for d1d5mb1

PDB Entry: 1d5m, 2 Å

PDB Description: x-ray crystal structure of hla-dr4 complexed with peptide and seb

SCOP Domain Sequences for d1d5mb1:

Sequence, based on SEQRES records:

>d1d5mb1 b.1.1.2 (B:93-190) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DR group}
rrvypevtvypaktqplqhhnllvcsvngfypgsievrwfrngqeektgvvstgliqngd
wtfqtlvmletvprsgevytcqvehpsvtspltvewra

Sequence, based on observed residues (ATOM records):

>d1d5mb1 b.1.1.2 (B:93-190) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DR group}
rrvypevtvypanllvcsvngfypgsievrwfrngqeektgvvstgliqngdwtfqtlvm
letvprsgevytcqvehpsvtspltvewra

Timeline for d1d5mb1:

• d1d5mb1 first appeared (with stable ids) in SCOP 1.55
  
• d1d5mb1 appears in SCOP 1.63
  
• d1d5mb1 appears in SCOP 1.67
  
• d1d5mb1 appears in the current release, SCOPe 2.08