SCOPe 2.06: Domain d3s1jc_: 3s1j C:

Lineage for d3s1jc_ (3s1j C:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.0: automated matches [191420] (1 protein)
   not a true family

6. Protein automated matches [190590] (21 species)
   not a true protein

7. Species Methylacidiphilum infernorum [TaxId:481448] [195689] (5 PDB entries)

8. Domain d3s1jc_: 3s1j C: [216170]
   automated match to d2zlua_
   complexed with act, hem, so4

Details for d3s1jc_

PDB Entry: 3s1j, 1.8 Å

PDB Description: Crystal structure of acetate-bound hell's gate globin I

PDB Compounds: (C:) Hemoglobin-like flavoprotein

SCOPe Domain Sequences for d3s1jc_:

Sequence; same for both SEQRES and ATOM records:

>d3s1jc_ a.1.1.0 (C:) automated matches {Methylacidiphilum infernorum [TaxId: 481448]}
idqkekelikeswkriepnkneigllfyanlfkeeptvsvlfqnpissqsrklmqvlgil
vqgidnlegliptlqdlgrrhkqygvvdshyplvgdcllksiqeylgqgfteeakaawtk
vygiaaqvmta

Timeline for d3s1jc_:

• d3s1jc_ first appeared in SCOPe 2.03
  
• d3s1jc_ appears in SCOPe 2.05
  
• d3s1jc_ appears in SCOPe 2.07
  
• d3s1jc_ appears in the current release, SCOPe 2.08