Lineage for d1d5ma1 (1d5m A:82-181)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 783929Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 784786Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species)
  7. 784794Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88621] (29 PDB entries)
    Uniprot P01903 28-207
    probably orthologous to the mouse I-E group
  8. 784796Domain d1d5ma1: 1d5m A:82-181 [21617]
    Other proteins in same PDB: d1d5ma2, d1d5mb1, d1d5mb2, d1d5mc1, d1d5mc2
    complexed with ace, nag

Details for d1d5ma1

PDB Entry: 1d5m (more details), 2 Å

PDB Description: x-ray crystal structure of hla-dr4 complexed with peptide and seb
PDB Compounds: (A:) hla class II histocompatibility antigen

SCOP Domain Sequences for d1d5ma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d5ma1 b.1.1.2 (A:82-181) Class II MHC alpha chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]}
itnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpre
dhlfrkfhylpflpstedvydcrvehwgldepllkhwefd

SCOP Domain Coordinates for d1d5ma1:

Click to download the PDB-style file with coordinates for d1d5ma1.
(The format of our PDB-style files is described here.)

Timeline for d1d5ma1: