Lineage for d3s1ia_ (3s1i A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1715732Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1715733Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1718504Family a.1.1.0: automated matches [191420] (1 protein)
    not a true family
  6. 1718505Protein automated matches [190590] (18 species)
    not a true protein
  7. 1718572Species Methylacidiphilum infernorum [TaxId:481448] [195689] (5 PDB entries)
  8. 1718576Domain d3s1ia_: 3s1i A: [216165]
    automated match to d2zlua_
    complexed with hem, oxy, so4

Details for d3s1ia_

PDB Entry: 3s1i (more details), 1.77 Å

PDB Description: Crystal structure of oxygen-bound hell's gate globin I
PDB Compounds: (A:) Hemoglobin-like flavoprotein

SCOPe Domain Sequences for d3s1ia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3s1ia_ a.1.1.0 (A:) automated matches {Methylacidiphilum infernorum [TaxId: 481448]}
idqkekelikeswkriepnkneigllfyanlfkeeptvsvlfqnpissqsrklmqvlgil
vqgidnlegliptlqdlgrrhkqygvvdshyplvgdcllksiqeylgqgfteeakaawtk
vygiaaqvmta

SCOPe Domain Coordinates for d3s1ia_:

Click to download the PDB-style file with coordinates for d3s1ia_.
(The format of our PDB-style files is described here.)

Timeline for d3s1ia_: