Lineage for d1a6ab1 (1a6a B:93-191)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 158799Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 159086Protein Class II MHC, C-terminal domains of alpha and beta chains [49132] (12 species)
  7. 159133Species Human (Homo sapiens), HLA-DR3 [TaxId:9606] [49136] (1 PDB entry)
  8. 159135Domain d1a6ab1: 1a6a B:93-191 [21616]
    Other proteins in same PDB: d1a6aa2, d1a6ab2

Details for d1a6ab1

PDB Entry: 1a6a (more details), 2.75 Å

PDB Description: the structure of an intermediate in class ii mhc maturation: clip bound to hla-dr3
PDB Compounds: (B:)

SCOP Domain Sequences for d1a6ab1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a6ab1 b.1.1.2 (B:93-191) Class II MHC, C-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DR3}
rrvhpkvtvypsktqplqhhnllvcsvsgfypgsievrwfrngqeektgvvstglihngd
wtfqtlvmletvprsgevytcqvehpsvtspltvewrar

SCOP Domain Coordinates for d1a6ab1:

Click to download the PDB-style file with coordinates for d1a6ab1.
(The format of our PDB-style files is described here.)

Timeline for d1a6ab1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1a6ab2