SCOPe 2.03: Domain d3s14c1: 3s14 C:3-41,C:173-268

Lineage for d3s14c1 (3s14 C:3-41,C:173-268)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.74: DCoH-like [55247] (5 superfamilies)
   beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta

4. Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (2 families)
   form homo and heterodimers

5. Family d.74.3.1: RNA polymerase alpha subunit dimerisation domain [55258] (2 proteins)

6. Protein RPB3 [64315] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [224933] (1 PDB entry)

8. Domain d3s14c1: 3s14 C:3-41,C:173-268 [216144]
   Other proteins in same PDB: d3s14a_, d3s14b_, d3s14c2, d3s14e1, d3s14e2, d3s14f_, d3s14h_, d3s14i1, d3s14i2, d3s14j_, d3s14k_, d3s14l_
   automated match to d1twfc1
   protein/DNA complex; protein/RNA complex; complexed with mg, zn

Details for d3s14c1

PDB Entry: 3s14, 2.85 Å

PDB Description: rna polymerase ii initiation complex with a 6-nt rna

PDB Compounds: (C:) DNA-directed RNA polymerase II subunit RPB3

SCOPe Domain Sequences for d3s14c1:

Sequence; same for both SEQRES and ATOM records:

>d3s14c1 d.74.3.1 (C:3-41,C:173-268) RPB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
eegpqvkireaskdnvdfilsnvdlamanslrrvmiaeiXaaaiefeydpwnklkhtdyw
yeqdsakewpqsknceyedppnegdpfdykaqadtfymnvesvgsipvdqvvvrgidtlq
kkvasillaltqmdqd

Timeline for d3s14c1:

• d3s14c1 is new in SCOPe 2.03-stable
  
• d3s14c1 appears in SCOPe 2.04
  
• d3s14c1 appears in the current release, SCOPe 2.08