Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily) duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets |
Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) |
Family d.157.1.0: automated matches [191360] (1 protein) not a true family |
Protein automated matches [190418] (15 species) not a true protein |
Species Escherichia coli [TaxId:562] [226145] (6 PDB entries) |
Domain d3s0zb_: 3s0z B: [216141] automated match to d3rkka_ complexed with zn |
PDB Entry: 3s0z (more details), 2.5 Å
SCOPe Domain Sequences for d3s0zb_:
Sequence, based on SEQRES records: (download)
>d3s0zb_ d.157.1.0 (B:) automated matches {Escherichia coli [TaxId: 562]} gdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlvvdtawtddqtaqilnwik qeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlapqegmvaaqhsltfaan gwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggclikdskakslgnlgdadt ehyaasarafgaafpkasmivmshsapdsraaithtarmadklr
>d3s0zb_ d.157.1.0 (B:) automated matches {Escherichia coli [TaxId: 562]} gdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlvvdtawtddqtaqilnwik qeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlapqegmvaaqhsltfaan patapnfgplkvfypgpghtsdnitvgidgtdiafggclikdskakslgnlgdadtehya asarafgaafpkasmivmshsapdsraaithtarmadklr
Timeline for d3s0zb_: