Lineage for d3s0za_ (3s0z A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555486Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2555487Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 2555981Family d.157.1.0: automated matches [191360] (1 protein)
    not a true family
  6. 2555982Protein automated matches [190418] (24 species)
    not a true protein
  7. 2556001Species Escherichia coli [TaxId:562] [226145] (15 PDB entries)
  8. 2556009Domain d3s0za_: 3s0z A: [216140]
    automated match to d3rkka_
    complexed with zn

Details for d3s0za_

PDB Entry: 3s0z (more details), 2.5 Å

PDB Description: Crystal structure of New Delhi Metallo-beta-lactamase (NDM-1)
PDB Compounds: (A:) metallo-beta-lactamase

SCOPe Domain Sequences for d3s0za_:

Sequence, based on SEQRES records: (download)

>d3s0za_ d.157.1.0 (A:) automated matches {Escherichia coli [TaxId: 562]}
gdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlvvdtawtddqtaqilnwik
qeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlapqegmvaaqhsltfaan
gwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggclikdskakslgnlgdadt
ehyaasarafgaafpkasmivmshsapdsraaithtarmadklr

Sequence, based on observed residues (ATOM records): (download)

>d3s0za_ d.157.1.0 (A:) automated matches {Escherichia coli [TaxId: 562]}
gdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlvvdtawtddqtaqilnwik
qeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlapqegmvaaqhsltfaan
patapnfgplkvfypgpghtsdnitvgidgtdiafggclikdskakslgnlgdadtehya
asarafgaafpkasmivmshsapdsraaithtarmadklr

SCOPe Domain Coordinates for d3s0za_:

Click to download the PDB-style file with coordinates for d3s0za_.
(The format of our PDB-style files is described here.)

Timeline for d3s0za_: