SCOPe 2.03: Domain d1hqra1: 1hqr A:82-181

Lineage for d1hqra1 (1hqr A:82-181)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species)

7. Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88621] (37 PDB entries)
   Uniprot P01903 28-207
   probably orthologous to the mouse I-E group

8. Domain d1hqra1: 1hqr A:82-181 [21613]
   Other proteins in same PDB: d1hqra2, d1hqrb1, d1hqrb2, d1hqrd1, d1hqrd2
   complexed with zn

Details for d1hqra1

PDB Entry: 1hqr, 3.2 Å

PDB Description: crystal structure of a superantigen bound to the high-affinity, zinc-dependent site on mhc class ii

PDB Compounds: (A:) hla-dr alpha chain

SCOPe Domain Sequences for d1hqra1:

Sequence, based on SEQRES records:

>d1hqra1 b.1.1.2 (A:82-181) Class II MHC alpha chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]}
itnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpre
dhlfrkfhylpflpstedvydcrvehwgldepllkhwefd

Sequence, based on observed residues (ATOM records):

>d1hqra1 b.1.1.2 (A:82-181) Class II MHC alpha chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]}
itnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvtgvsetvflpred
hlfrkfhylpflpstedvydcrvehwgldepllkhwefd

Timeline for d1hqra1:

• d1hqra1 first appeared (with stable ids) in SCOP 1.55
  
• d1hqra1 appears in SCOPe 2.02
  
• d1hqra1 appears in SCOPe 2.04
  
• d1hqra1 appears in the current release, SCOPe 2.08