Lineage for d1hqra1 (1hqr A:82-181)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 452577Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 453045Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species)
  7. 453053Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88621] (29 PDB entries)
    probably orthologous to the mouse I-E group
  8. 453091Domain d1hqra1: 1hqr A:82-181 [21613]
    Other proteins in same PDB: d1hqra2, d1hqrb1, d1hqrb2, d1hqrd1, d1hqrd2

Details for d1hqra1

PDB Entry: 1hqr (more details), 3.2 Å

PDB Description: crystal structure of a superantigen bound to the high-affinity, zinc-dependent site on mhc class ii

SCOP Domain Sequences for d1hqra1:

Sequence, based on SEQRES records: (download)

>d1hqra1 b.1.1.2 (A:82-181) Class II MHC alpha chain, C-terminal domain {Human (Homo sapiens), HLA-DR group}
itnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpre
dhlfrkfhylpflpstedvydcrvehwgldepllkhwefd

Sequence, based on observed residues (ATOM records): (download)

>d1hqra1 b.1.1.2 (A:82-181) Class II MHC alpha chain, C-terminal domain {Human (Homo sapiens), HLA-DR group}
itnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvtgvsetvflpred
hlfrkfhylpflpstedvydcrvehwgldepllkhwefd

SCOP Domain Coordinates for d1hqra1:

Click to download the PDB-style file with coordinates for d1hqra1.
(The format of our PDB-style files is described here.)

Timeline for d1hqra1: