Lineage for d1bx2e1 (1bx2 E:93-191)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 783929Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 784902Protein Class II MHC beta chain, C-terminal domain [88625] (6 species)
  7. 784910Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88628] (39 PDB entries)
    Uniprot P04229 30-219
    probably orthologous to the mouse I-E group
  8. 784955Domain d1bx2e1: 1bx2 E:93-191 [21612]
    Other proteins in same PDB: d1bx2a1, d1bx2a2, d1bx2b2, d1bx2d1, d1bx2d2, d1bx2e2
    complexed with nag

Details for d1bx2e1

PDB Entry: 1bx2 (more details), 2.6 Å

PDB Description: crystal structure of hla-dr2 (dra*0101,drb1*1501) complexed with a peptide from human myelin basic protein
PDB Compounds: (E:) protein (hla-dr2)

SCOP Domain Sequences for d1bx2e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bx2e1 b.1.1.2 (E:93-191) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]}
rrvqpkvtvypsktqplqhhnllvcsvsgfypgsievrwflngqeekagmvstgliqngd
wtfqtlvmletvprsgevytcqvehpsvtspltvewrar

SCOP Domain Coordinates for d1bx2e1:

Click to download the PDB-style file with coordinates for d1bx2e1.
(The format of our PDB-style files is described here.)

Timeline for d1bx2e1: