SCOPe 2.06: Domain d3ry5a1: 3ry5 A:4-88

Lineage for d3ry5a1 (3ry5 A:4-88)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.4: I set domains [49159] (39 proteins)

6. Protein automated matches [190803] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188070] (30 PDB entries)

8. Domain d3ry5a1: 3ry5 A:4-88 [216115]
   automated match to d2fcba1

Details for d3ry5a1

PDB Entry: 3ry5, 2.3 Å

PDB Description: Three-dimensional structure of glycosylated fcgammariia (high-responder polymorphism)

PDB Compounds: (A:) Low affinity immunoglobulin gamma Fc region receptor II-a

SCOPe Domain Sequences for d3ry5a1:

Sequence; same for both SEQRES and ATOM records:

>d3ry5a1 b.1.1.4 (A:4-88) automated matches {Human (Homo sapiens) [TaxId: 9606]}
appkavlkleppwinvlqedsvtltcqgarspesdsiqwfhngnlipthtqpsyrfkann
ndsgeytcqtgqtslsdpvhltvls

Timeline for d3ry5a1:

• d3ry5a1 first appeared in SCOPe 2.03
  
• d3ry5a1 appears in SCOPe 2.05
  
• d3ry5a1 appears in SCOPe 2.07
  
• d3ry5a1 appears in the current release, SCOPe 2.08