Lineage for d3ry4a1 (3ry4 A:4-88)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2364875Family b.1.1.4: I set domains [49159] (39 proteins)
  6. 2365289Protein automated matches [190803] (3 species)
    not a true protein
  7. 2365290Species Human (Homo sapiens) [TaxId:9606] [188070] (28 PDB entries)
  8. 2365293Domain d3ry4a1: 3ry4 A:4-88 [216113]
    automated match to d1fcga1
    complexed with gol, nag

Details for d3ry4a1

PDB Entry: 3ry4 (more details), 1.5 Å

PDB Description: 1.5 angstrom resolution structure of glycosylated fcgammariia (low- responder polymorphism)
PDB Compounds: (A:) Low affinity immunoglobulin gamma Fc region receptor II-a

SCOPe Domain Sequences for d3ry4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ry4a1 b.1.1.4 (A:4-88) automated matches {Human (Homo sapiens) [TaxId: 9606]}
appkavlkleppwinvlqedsvtltcqgarspesdsiqwfhngnlipthtqpsyrfkann
ndsgeytcqtgqtslsdpvhltvlf

SCOPe Domain Coordinates for d3ry4a1:

Click to download the PDB-style file with coordinates for d3ry4a1.
(The format of our PDB-style files is described here.)

Timeline for d3ry4a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ry4a2