Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (17 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [224855] (654 PDB entries) |
Domain d3rvvc2: 3rvv C:111-211 [216098] Other proteins in same PDB: d3rvvc1, d3rvvc3 automated match to d2fbjl2 complexed with ca, edo, nag |
PDB Entry: 3rvv (more details), 1.9 Å
SCOPe Domain Sequences for d3rvvc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rvvc2 b.1.1.2 (C:111-211) automated matches {Mouse (Mus musculus) [TaxId: 10090]} aaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskd stysmsstltltkdeyerhnsytceathktstspivksfnr
Timeline for d3rvvc2: