Lineage for d3rvsa_ (3rvs A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1356042Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1356043Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 1356044Family c.23.1.1: CheY-related [52173] (26 proteins)
  6. 1356316Protein automated matches [190177] (7 species)
    not a true protein
  7. 1356348Species Escherichia coli [TaxId:83333] [195427] (10 PDB entries)
  8. 1356355Domain d3rvsa_: 3rvs A: [216091]
    automated match to d3rvra_
    complexed with gol, mn, so4, wo4

Details for d3rvsa_

PDB Entry: 3rvs (more details), 2.1 Å

PDB Description: structure of the cheyn59d/e89r tungstate complex
PDB Compounds: (A:) Chemotaxis protein cheY

SCOPe Domain Sequences for d3rvsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rvsa_ c.23.1.1 (A:) automated matches {Escherichia coli [TaxId: 83333]}
hmadkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwd
mpnmdglellktiradgamsalpvlmvtarakkeniiaaaqagasgyvvkpftaatleek
lnkifeklgm

SCOPe Domain Coordinates for d3rvsa_:

Click to download the PDB-style file with coordinates for d3rvsa_.
(The format of our PDB-style files is described here.)

Timeline for d3rvsa_: