SCOPe 2.03: Domain d3rvpb_: 3rvp B:

Lineage for d3rvpb_ (3rvp B:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.1: CheY-related [52173] (26 proteins)

6. Protein automated matches [190177] (7 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [195427] (10 PDB entries)

8. Domain d3rvpb_: 3rvp B: [216090]
   automated match to d3rvqa_
   complexed with bef, gol, mg, mn, so4

Details for d3rvpb_

PDB Entry: 3rvp, 2.4 Å

PDB Description: structure of the chey-bef3 complex with substitutions at 59 and 89: n59d and e89k

PDB Compounds: (B:) Chemotaxis protein cheY

SCOPe Domain Sequences for d3rvpb_:

Sequence; same for both SEQRES and ATOM records:

>d3rvpb_ c.23.1.1 (B:) automated matches {Escherichia coli [TaxId: 83333]}
hmadkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwd
mpnmdglellktiradgamsalpvlmvtakakkeniiaaaqagasgyvvkpftaatleek
lnkifeklgm

Timeline for d3rvpb_:

• d3rvpb_ is new in SCOPe 2.03-stable
  
• d3rvpb_ appears in SCOPe 2.04
  
• d3rvpb_ appears in the current release, SCOPe 2.08, called d3rvpb1