SCOP 1.61: Domain d1fv1e1: 1fv1 E:93-190

Lineage for d1fv1e1 (1fv1 E:93-190)

Root: SCOP 1.61
Class b: All beta proteins [48724] (111 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
Superfamily b.1.1: Immunoglobulin [48726] (6 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
Protein Class II MHC, C-terminal domains of alpha and beta chains [49132] (12 species)
Species Human (Homo sapiens), HLA-DR2 [TaxId:9606] [49135] (3 PDB entries)
Domain d1fv1e1: 1fv1 E:93-190 [21608]
Other proteins in same PDB: d1fv1a2, d1fv1b2, d1fv1d2, d1fv1e2

Details for d1fv1e1

PDB Entry: 1fv1 (more details), 1.9 Å

PDB Description: structural basis for the binding of an immunodominant peptide from myelin basic protein in different registers by two hla-dr2 alleles

SCOP Domain Sequences for d1fv1e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fv1e1 b.1.1.2 (E:93-190) Class II MHC, C-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DR2}
rrvepkvtvypartqtlqhhnllvcsvngfypgsievrwfrnsqeekagvvstgliqngd
wtfqtlvmletvprsgevytcqvehpsvtspltvewra

SCOP Domain Coordinates for d1fv1e1:

Click to download the PDB-style file with coordinates for d1fv1e1.
(The format of our PDB-style files is described here.)

Timeline for d1fv1e1: