![]() | Class b: All beta proteins [48724] (126 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins) |
![]() | Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species) |
![]() | Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88621] (23 PDB entries) probably orthologous to the mouse I-E group |
![]() | Domain d1fv1d1: 1fv1 D:82-181 [21607] Other proteins in same PDB: d1fv1a2, d1fv1b1, d1fv1b2, d1fv1d2, d1fv1e1, d1fv1e2 complexed with cry, so4 |
PDB Entry: 1fv1 (more details), 1.9 Å
SCOP Domain Sequences for d1fv1d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fv1d1 b.1.1.2 (D:82-181) Class II MHC alpha chain, C-terminal domain {Human (Homo sapiens), HLA-DR group} itnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpre dhlfrkfhylpflpstedvydcrvehwgldepllkhwefd
Timeline for d1fv1d1: