Lineage for d1fv1a1 (1fv1 A:82-181)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 288543Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 288908Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species)
  7. 288913Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88621] (23 PDB entries)
    probably orthologous to the mouse I-E group
  8. 288914Domain d1fv1a1: 1fv1 A:82-181 [21605]
    Other proteins in same PDB: d1fv1a2, d1fv1b1, d1fv1b2, d1fv1d2, d1fv1e1, d1fv1e2

Details for d1fv1a1

PDB Entry: 1fv1 (more details), 1.9 Å

PDB Description: structural basis for the binding of an immunodominant peptide from myelin basic protein in different registers by two hla-dr2 alleles

SCOP Domain Sequences for d1fv1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fv1a1 b.1.1.2 (A:82-181) Class II MHC alpha chain, C-terminal domain {Human (Homo sapiens), HLA-DR group}
itnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpre
dhlfrkfhylpflpstedvydcrvehwgldepllkhwefd

SCOP Domain Coordinates for d1fv1a1:

Click to download the PDB-style file with coordinates for d1fv1a1.
(The format of our PDB-style files is described here.)

Timeline for d1fv1a1: