![]() | Class b: All beta proteins [48724] (104 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
![]() | Protein Class II MHC, C-terminal domains of alpha and beta chains [49132] (10 species) |
![]() | Species Human (Homo sapiens), HLA-DR2 [TaxId:9606] [49135] (3 PDB entries) |
![]() | Domain d1fv1a1: 1fv1 A:82-181 [21605] Other proteins in same PDB: d1fv1a2, d1fv1b2, d1fv1d2, d1fv1e2 |
PDB Entry: 1fv1 (more details), 1.9 Å
SCOP Domain Sequences for d1fv1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fv1a1 b.1.1.2 (A:82-181) Class II MHC, C-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DR2} itnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpre dhlfrkfhylpflpstedvydcrvehwgldepllkhwefd
Timeline for d1fv1a1: