Lineage for d3rswb_ (3rsw B:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1324198Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 1324199Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 1324658Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
    ten-stranded meander beta-sheet folded upon itself
    relates to the common fold by opening the barrel and insertion of beta-hairpin
  6. 1324891Protein automated matches [190295] (5 species)
    not a true protein
  7. 1324907Species Human (Homo sapiens) [TaxId:9606] [187133] (21 PDB entries)
  8. 1324944Domain d3rswb_: 3rsw B: [216041]
    automated match to d1hmsa_

Details for d3rswb_

PDB Entry: 3rsw (more details), 2.6 Å

PDB Description: Crystal Structure of Heart Fatty Acid Binding Protein (FABP3)
PDB Compounds: (B:) Fatty acid-binding protein, heart

SCOPe Domain Sequences for d3rswb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rswb_ b.60.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mvdaflgtwklvdsknfddymkslgvgfatrqvasmtkpttiiekngdiltlkthstfkn
teisfklgvefdettaddrkvksivtldggklvhlqkwdgqettlvrelidgkliltlth
gtavctrtyekea

SCOPe Domain Coordinates for d3rswb_:

Click to download the PDB-style file with coordinates for d3rswb_.
(The format of our PDB-style files is described here.)

Timeline for d3rswb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3rswa_