SCOP 1.75: Domain d1sebf1: 1seb F:93-192

Lineage for d1sebf1 (1seb F:93-192)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Class II MHC beta chain, C-terminal domain [88625] (6 species)

7. Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88628] (39 PDB entries)
   Uniprot P04229 30-219
   probably orthologous to the mouse I-E group

8. Domain d1sebf1: 1seb F:93-192 [21604]
   Other proteins in same PDB: d1seba1, d1seba2, d1sebb2, d1sebd1, d1sebd2, d1sebe1, d1sebe2, d1sebf2, d1sebh1, d1sebh2

Details for d1sebf1

PDB Entry: 1seb, 2.7 Å

PDB Description: complex of the human mhc class ii glycoprotein hla-dr1 and the bacterial superantigen seb

PDB Compounds: (F:) hla class II histocompatibility antigen

SCOP Domain Sequences for d1sebf1:

Sequence; same for both SEQRES and ATOM records:

>d1sebf1 b.1.1.2 (F:93-192) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]}
rrvepkvtvypsktqplqhhnllvcsvsgfypgsievrwfrngqeekagvvstgliqngd
wtfqtlvmletvprsgevytcqvehpsvtspltvewrars

Timeline for d1sebf1:

• d1sebf1 first appeared (with stable ids) in SCOP 1.55
  
• d1sebf1 appears in SCOP 1.73
  
• d1sebf1 appears in SCOPe 2.01
  
• d1sebf1 appears in the current release, SCOPe 2.08