| Class b: All beta proteins [48724] (174 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species) |
| Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88621] (29 PDB entries) Uniprot P01903 28-207 probably orthologous to the mouse I-E group |
| Domain d1sebe1: 1seb E:82-181 [21603] Other proteins in same PDB: d1seba2, d1sebb1, d1sebb2, d1sebd1, d1sebd2, d1sebe2, d1sebf1, d1sebf2, d1sebh1, d1sebh2 |
PDB Entry: 1seb (more details), 2.7 Å
SCOPe Domain Sequences for d1sebe1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sebe1 b.1.1.2 (E:82-181) Class II MHC alpha chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]}
itnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpre
dhlfrkfhylpflpstedvydcrvehwgldepllkhwefd
Timeline for d1sebe1: