SCOP 1.65: Domain d1sebe1: 1seb E:82-181

Lineage for d1sebe1 (1seb E:82-181)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species)

7. Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88621] (23 PDB entries)
   probably orthologous to the mouse I-E group

8. Domain d1sebe1: 1seb E:82-181 [21603]
   Other proteins in same PDB: d1seba2, d1sebb1, d1sebb2, d1sebd1, d1sebd2, d1sebe2, d1sebf1, d1sebf2, d1sebh1, d1sebh2

Details for d1sebe1

PDB Entry: 1seb, 2.7 Å

PDB Description: complex of the human mhc class ii glycoprotein hla-dr1 and the bacterial superantigen seb

SCOP Domain Sequences for d1sebe1:

Sequence; same for both SEQRES and ATOM records:

>d1sebe1 b.1.1.2 (E:82-181) Class II MHC alpha chain, C-terminal domain {Human (Homo sapiens), HLA-DR group}
itnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpre
dhlfrkfhylpflpstedvydcrvehwgldepllkhwefd

Timeline for d1sebe1:

• d1sebe1 first appeared (with stable ids) in SCOP 1.55
  
• d1sebe1 appears in SCOP 1.63
  
• d1sebe1 appears in SCOP 1.67
  
• d1sebe1 appears in the current release, SCOPe 2.08