Lineage for d1sebe1 (1seb E:82-181)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 103279Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 103536Protein Class II MHC, C-terminal domains of alpha and beta chains [49132] (11 species)
  7. 103543Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [49134] (6 PDB entries)
  8. 103564Domain d1sebe1: 1seb E:82-181 [21603]
    Other proteins in same PDB: d1seba2, d1sebb2, d1sebd1, d1sebd2, d1sebe2, d1sebf2, d1sebh1, d1sebh2

Details for d1sebe1

PDB Entry: 1seb (more details), 2.7 Å

PDB Description: complex of the human mhc class ii glycoprotein hla-dr1 and the bacterial superantigen seb
PDB Compounds: (E:)

SCOP Domain Sequences for d1sebe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sebe1 b.1.1.2 (E:82-181) Class II MHC, C-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DR1}
itnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpre
dhlfrkfhylpflpstedvydcrvehwgldepllkhwefd

SCOP Domain Coordinates for d1sebe1:

Click to download the PDB-style file with coordinates for d1sebe1.
(The format of our PDB-style files is described here.)

Timeline for d1sebe1: