Lineage for d3rrla_ (3rrl A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2169412Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
    core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456
  4. 2169413Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families) (S)
  5. 2169699Family c.124.1.0: automated matches [191609] (1 protein)
    not a true family
  6. 2169700Protein automated matches [191112] (14 species)
    not a true protein
  7. 2169807Species Helicobacter pylori [TaxId:210] [226164] (1 PDB entry)
  8. 2169808Domain d3rrla_: 3rrl A: [216023]
    automated match to d1k6da_
    complexed with gol

Details for d3rrla_

PDB Entry: 3rrl (more details), 2.29 Å

PDB Description: Complex structure of 3-oxoadipate coA-transferase subunit A and B from Helicobacter pylori 26695
PDB Compounds: (A:) Succinyl-CoA:3-ketoacid-coenzyme A transferase subunit A

SCOPe Domain Sequences for d3rrla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rrla_ c.124.1.0 (A:) automated matches {Helicobacter pylori [TaxId: 210]}
mnkvitdldkalsalkdgdtilvggfglcgipeyaidyiykkgikdlivvsnncgvddfg
lgillekkqikkiiasyvgenkifesqmlngeievvltpqgtlaenlhaggagipayytp
tgvgtliaqgkesrefngkeyileraitgdyglikayksdtlgnlvfrktarnfnplcam
aakicvaeveeivpageldpdeihlpgiyvqhiykgekfekriekittrs

SCOPe Domain Coordinates for d3rrla_:

Click to download the PDB-style file with coordinates for d3rrla_.
(The format of our PDB-style files is described here.)

Timeline for d3rrla_: